GNU Manuals Online. GNU Project. This table lists official GNU packages with links to. When a package has. If a package has no. Many packages could be listed in any of several categories, but for. Free Software Directory. Interactive Manual Software' title='Interactive Manual Software' />INTERACTIVE CONTROL. Nutrition software with powerfull search engine to tag healthy foods and identify sources of a poor diet. Get advice on when to use manual vs. Bug reports for any discussion about specific manuals, please. For discussion about this page in. GNU maintainer and want to correct. More GNU Project documentation. Archiving. Business and productivity. Documentation translation. GNU organization. Internet applications. Live communications. Software development. Software libraries. System administration. Text creation and manipulation. Version control. Web authoring. Archiving Cpio. Manage cpio and tar file archives. G General file decompression using lzw. Paxutils. Manage cpio, tar, and pax file archives. Sharutils. Archives in shell scripts, uuencodeuudecode. Tar. Managing tar archives. Xorriso. Create, manipulate, burn ISO 9. AudioCcd. 2cue. CCD to CUE sheet conversion. EMMSEmacs Multimedia System. Gmediaserver. UPn. P compatible media server. GNUfm. Social music explorations. GNUmp. 3d. Server for streaming audio files. GNUpod. Manage portable audio device. Radio. Software radio implementations. GNUsound. Multi track sound editor for GNOME. Guile SDLGuile interface for SDL Simple Direct. Media Layer. guile sdl homeLibcdiocd textCD Input and Control library. Speex. Library for patent free audio compression format. Xhippo. Generic playlist manager program. Business and productivityBarcode. Convert text strings to printed bars in various standards. BPEL2o. WFNTranslating web service in BPEL to Open Workflow Nets. Foliot. An application for tracking time spent on projects. Gcal. Calculating and printing a wide variety of calendars. Gnu. Cash. Personal and small business financial accounting software. GNU Enterprise. Enterprise resource planning, et al. Gretl. Statistical analysis of economic data econometrics. Pem. Personal expenses manager. Taler. Electronic payments for a liberal society. DatabaseFerret. Entityrelationship based data modeler. Gdbm. Hash library of database functions compatible with traditional dbm. Guile dbi. Guile database abstraction layer. Gurgle. GNU Report Generator Language. Libdbh. Advanced library for disk based hash tables. Metaexchange. Manipulate metadata from OAI PMH and Z3. Recutils. Manipulate plain text files as databases. Sqltutor. Interactively learn SQL by example. DictionariesDico. Implementation of DICT server RFC 2. Gcide. GNU Collaborative International Dictionary of English. Vera. List of acronyms. Documentation translationGNUjdoc. Japanese translations of GNU documents. GNUnited Nationsgnunweb transBuild system for www. Trans coord. Organizational infrastructure for translating www. EditorsEmacsada modeautotypeccmodecldired xebrowseediffeieioelispemacsepaerceshellflymakegnusidlwavemessagemh enxml modeorgpcl cvsrcircsemanticsmtpspeedbartrampvipviperwomanThe extensible, customizable, self documenting text editor. Available in print. Emacs Reference Cards. GNU Emacs Manual. Moe. Modeless, multiple buffer, user friendly 8 bit text editor. Nano. Small, user friendly console text editor. ReadlinehistoryrlusermanEdit command lines while typing, with history support. Zile. Zile is lossy Emacs, a lightweight Emacs clone. EducationDr. Geo. Interactive geometry software. Eprints. Web based repository software, with a default setup for research papers. Fisica. Lab. Educational application for solving physics problems. GCompris. Educational games for small children. Ggradebook. GNOME application to track students grades for teachers. Gleanextensible quizzing and tutorial for self study. GNUschool. Web application for educators, students, and school administrators. Gtypist. Typing tutor. Ignuit. Memorization aid based on Leitner flashcards. Java Training Wheels. A simplified Java environment for learning programming. MIX Development Kit. Virtual development environment for Knuths MIX. Available in print. GNU MDK. mdk homeEmailAnubis. SMTP message submission daemon. GNUbiff. Mail notification program. Mailman. Mailing list manager. Mailutils. Utilities and library for reading and serving mail. FontsFontopia. A console font editor. Fontutils. Scanned image, bitmap, outline font manipulation. Free UCS Outline Fonts. Unicode encoded outline fonts. Intlfonts. True. Type and BDF fonts covering many scripts. Unifont. Large bitmap font covering Unicodes Basic Multilingual Plane. GNU organizationGNU organizationmaintainstandardsGNU coding standards and maintainer information. GamesAcm. Multiplayer aerial combat simulation. Ball and Paddle. Ball and paddle game extensible with Guile. Chess. Full chess implementation. Dominion. Multi player world simulation and role playing game. Free. Dink. Twisted adventures of young pig farmer Dink Smallwood. Backgammon. Backgammon game. GNUbik. 3d Rubiks cube game. GNUgo. Play the game of Go. GNUjump. Game of jumping to the next floor, trying not to fall. GNUkart. Racing game. Robots. Program a little robot and watch him explore a world. GNUshogi. The game of Shogi Japanese chess. Leg. Libraries and engines for game programming. Liquid War 6. Multiplayer wargame where your army is a blob of liquid. Motti. Multiplayer strategy game. Rpge. Role playing game engine. Talkfilters. Convert English text to humorous dialects. XBoard. Graphical user interface for chess programs. Graphics3. DLDF3. D drawing with Meta. Post output. 3dldf homeDia. Diagram creation for GNOME. GIFTGNU Image Finding Tool, with query by example. GIMPGNU Image Manipulation Program. Gpaint. Simple paint program for GNOME. Gsegrafix. GNOME application to create scientific and engineering plots. Guile opengl. Guile binding for the Open. GL graphics API. guile opengl homeLibxmi. Library for rasterizing 2 d vector graphics. Maverik. Support interactive 3d virtual environments. Panorama. Framework for 3. D graphics production. Plotutils. Plotting utilities and library. Xao. SReal time fractal zoomer. HealthGNUmed. Paperless medical practice. GNUtrition. Nutrition analysis. Health. Health and hospital information system. InterfaceG Golf. Guile bindings for GObject Introspection. GNOMEThe GNU desktop environment. Gnu. DOSMS DOS like file manager, editor, and other tools. GNU Interactive Tools. Interactive utilities for file browsing, viewing, and more. GNUspeech. Extensible rule based text to speech. GTKCross platform toolkit for creating graphical user interfaces. Guile ncurses. Guile bindings to ncurses. Gxmessage. Open popup message window with buttons for return. Inklingreader. Wacom Inkling sketch format conversion and manipulation. Midnight Commander. Graphical file manager. Ncurses. Terminal emulation termcap, terminfo library. OO Browser. An interactive object oriented class browser for Emacs. Phantom. Home. Computer controlled home automation. Power. Guru. Monitoring, logging, and remote control of power generation. Remotecontrol. Management of IP enabled thermostats and other HVAC devices. Stalkerfs. Desktop search engine for local files, using FUSE. Termcap. Terminal independent display support. Termutils. The tput and tabs utilities for terminal operations. TRAMPTransparent Remote Access, Multiple Protocol GNU Emacs package. Internet applicationsAlive. Autologin and keep alive daemon. Artanis. Web application framework written in Guile. Consensus. Coordinate free software social networking projects. Freetalk. Extensible console based Jabber client. Gratuitous ARP Daemon. Broadcast gratuitous ARP requests for IPMI and more. Gnash. Flash movie player. GNUnet. Secure, decentralized, peer to peer networking framework. GNUzilla. Entirely free browser derived from Mozilla Firefox. Httptunnel. Bidirectional connection tunnelled inside HTTP requests. Icecat. Entirely free browser derived from Mozilla Firefox. Inetutils. Basic networking utilities. Jwhois. An extended whois client. Librejs. Browser add on that blocks nonfree nontrivial Java. Script. librejs homeLrzsz. Ras. Mol V2. 7. 5 Manual. Based on Ras. Mol 2. Roger Sayle. Biomolecular Structures Group. Glaxo Wellcome Research Development. Stevenage, Hertfordshire, UKVersion 2. August 1. 99. 5, Version 2. December 1. 99. 8Copyright Roger Sayle 1. Based on Mods by. Author. Version, Date. Copyright. Arne Mueller. Ras. Mol 2. 6x. 1 May 1. Arne Mueller 1. 99. Gary Grossman and. Marco Molinaro. Ras. Mol 2. 5 ucb November 1. Ras. Mol 2. 6 ucb November 1. UC RegentsModular. CHEMConsortium 1. Philippe Valadon. Ras. Top 1. 3 August 2. Philippe Valadon 2. Herbert J. Bernstein. Ras. Mol 2. 7. 0 March 1. Ras. Mol 2. 7. 1 June 1. Ras. Mol 2. 7. 1. January 2. 00. 1Ras. Mol 2. 7. 2 August 2. Ras. Mol 2. 7. 2. April 2. 00. 1Ras. Mol 2. 7. 2. 1. 1 January 2. Ras. Mol 2. 7. 3 February 2. Ras. Mol 2. 7. 3. Apr 0. 6Ras. Mol 2. November 2. 00. 7Ras. Mol 2. 7. 4. 1 January 2. Ras. Mol 2. 7. 4. March 2. 00. 8Ras. Mol 2. 7. 5 June 2. Ras. Mol 2. 7. 5. July 2. 00. 9 Herbert J. Bernstein 1. 99. 8 2. Ras. Mol 2. 7. 5 incorporates changes by T. Ikonen, G. Mc. Quillan, N. Darakev. and L. Andrews via the neartree package. Work on Ras. Mol 2. R1. 5GM0. 78. 07. National Institute. General Medical Sciences NIGMS, U. S. National Institutes of Health. ER6. 36. 01 1. 02. Office of Biological amp. Environmental Research BER, Office of Science, U. S. Department of. Energy. Ras. Mol 2. G. Todorov, Nan Jia. N. Darakev, P. Kamburov, G. Mc. Quillan, and J. Jemilawon. Work on Ras. Mol. 2. 7. 4 supported in part by grant 1. R1. 5GM0. 78. 07. NIGMSNIH and. grant ER6. BERDOE. Ras. Mol 2. Clarice Chigbo, Ricky Chachra, and Mamoru Yamanishi. Work. on Ras. Mol 2. DBI 0. 20. 30. 64, DBI 0. EF 0. 31. 26. 12 from the U. S. National Science Foundation and grant. DE FG0. 2 0. 3ER6. BERDOE. The content is solely the responsibility. The code for use of Ras. Mol under GTK in Ras. Mol 2. 7. 4. 2 was written by. Incorporating Translations by. Author. Item. Language. Isabel Servn Martnez,Jos Miguel Fernndez Fernndez. Manual. Spanish. Jos Miguel Fernndez Fernndez. Manual. Spanish. Fernando Gabriel Ranea. Spanish. Jean Pierre Demailly. French. Giuseppe Martini, Giovanni Paolella,A. Davassi, M. Masullo, C. Liotto. 2. 7. 1 menus and messages. Italian. G. Pozhvanov. Russian. G. Todorov. Bulgarian. Nan Jia, G. Todorov. 2. 7. 3 menus and messages. Chinese. Mamoru Yamanishi, Katajima Hajime. Japanese. This Release by. Herbert J. Bernstein. Bernstein Sons, P. O. Box 1. 77, Bellport, NY, USACopyright Herbert J. Bernstein 1. 99. 8 2. The original Ras. Mol manual was created by Roger Sayle. In July 1. 99. 6. Dr. Margaret Wong of the Chemistry Department, Swinburne University. Technology, Australia, made extensive revisions to the Ras. Mol 2. 5. manual to accurately reflect the operation of Ras. Mol 2. 6. Eric Martz. University of Massachusetts made further revisions. In May. 1. 99. 7, William Mc. Clure of Carnegie Mellon University reorganized the. HTML version of the manual into multiple sections which could be. Portions of the 2. Ras. Mol manual were derived with permission from. William Mc. Clures version using Roger Sayles rasmol. Changes have been made in. August 2. 00. 0 for Ras. Mol version 2. 7. January 2. 00. 1 for Ras. Mol. version 2. 7. April 2. 00. 1 for Ras. Mol version 2. 7. February 2. 00. 5 for Ras. Mol version 2. 7. November 2. 00. 7. January 2. 00. 8 and March 2. Taboo Game Wedding Version Of Jack. Ras. Mol version 2. Documentation Last Updated 1. July 2. 00. 9Edited by Herbert J. Bernstein and Frances C. Bernstein. Translations. Thanks to the efforts of Jos Miguel Fernndez. Fernndez Departamento. Bioqumica y Biologa Molecular. Universidad de Granada. Espaa jmfernanugr. Manual for Rasmol version 2. Spanish is now available. La traduccin espaola del manual de la. Dra. Wong revisada por Eric Martz fue realizada por. Isabel Servn Martnez y Jos Miguel Fernndez. Fernndez. La actual traduccin del Manual de Ras. Mol 2. 7. 1. ha sido realizada usando como base la anterior de Ras. Mol 2. 6 por. Jos Miguel Fernndez Fernndez. Thanks to translations by Fernando Gabriel Ranea lt davincidinamica. Ras. Mol is now. capable of rendering most menu items and messages in Spanish. Jean Pierre Demailly lt jean pierre. French. translations of menus and messages in January 2. Giuseppe Martini lt martiniiigb. Giovanni Paolella lt paolelladbbm. A. Davassi, M. Masullo and C. Liotto provided Italian. March 2. 00. 1. THIS IS A PRELIMINARY RELEASE INVOLVING EXTENSIVE MODIFICATIONS USE WITH CAUTION IMPORTANT. This version is based directly on Ras. Mol version 2. 7. Ras. Mol version 2. Ras. Mol version 2. Ras. Mol version 2. Ras. Mol vesion 2. Ras. Mol version 2. Ras. Mol version 2. Ras. Mol version 2. Ras. Mol. version 2. CIF. 2, on Ras. Mol version 2. Ras. Mol version. Ras. Mol 2. 5 ucb and 2. Please read the file NOTICE for. GPL or RASLIC. Table of Contents. Notices. Copying. Introduction. General Operation. Command Reference. Internal Parameters. Atom Expressions. Predefined Sets. Colour Schemes. File Formats. File Machine Specific Support. Bibliography. Ras. Mol Copyright Roger Sayle 1. Version 2. 6x. 1 Mods Copyright Arne Mueller 1. Versions 2. 5 ucb and 2. Mods Copyright. UC RegentsModular. CHEM Consortium 1. Ras. Top 1. 3 Copyright Philippe Valadon 2. Version 2. 7. 0, 2. Mods. Copyright Herbert J. Bernstein 1. 99. 8 2. All rights reserved. Use of copyright notice does not imply publication or. The information supplied in this document is believed to be true. Information in this document is subject. This software has been created from several sources. Much of the code is. Ras. Mol 2. 6, as created by Roger Sayle. The torsion angle code, new POVRAY3 code and other features are derived from. Ras. Mol. 2. 6x. 1 revisions by Arne Mueller. The Ramachandran printer plot code was derived from fisipl created by Frances C. Bernstein. See the Protein Data Bank program tape. The code to display multiple molecules and to allow bond rotation is derived. UCB mods by Gary Grossman and Marco Molinaro. Eileen Lewis of the Modular. CHEM Consortium. http mc. CCHem. Berkeley. EDURas. Mol. The CIF modifications make use of a library based in part on CBFlib by. Paul J. Ellis and Herbert J. Bernstein. http www. CBF. Parts of CBFlib is loosely based on the CIFPARSE software package from the NDB. Rutgers university. CIFPARSE. Please type the Ras. Mol commands. help copying. CIFPARSE. for applicable notices. Please type. help copyright. If you use Ras. Mol V2. Ras. Mol command. This version is based directly on Ras. Mol version 2. 7. Ras. Mol verion 2. Ras. Mol version 2. Ras. Mol version 2. Ras. Mol version 2. Ras. Mol version 2. Rasmol version 2. Ras. Mol. version 2. Ras. Top version 1. Ras. Mol 2. 5 ucb and 2. CIF. 2, Ras. Mol 2. Ras. Mol2. 6. 4. Ras. Mol 2. 7. 5 may be distributed under the terms of the GNU. General Public License the GPL, see. GPL or type the command. Ras. Mol 2. 7. 5 may be distributed under the RASMOL license. See the file NOTICE. GNU GENERAL PUBLIC LICENSE                       Version 2, June 1. Copyright C 1. 98. Free Software Foundation, Inc. Temple Place, Suite 3. Boston, MA  0. 21. USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble  The licenses for most software are designed to take away yourfreedom to share and change it. By contrast, the GNU General Public. License is intended to guarantee your freedom to share and change freesoftware to make sure the software is free for all its users. This. General Public License applies to most of the Free Software.